PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015889931.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 611aa    MW: 67427.1 Da    PI: 4.9012
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015889931.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3551.1e-1082446112374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      ++Ll+cA+ +++++  +a + L rl+e +s++gdp++R++++fteAL +r++    +  k++++ et+   s+e +  +k++++++P+ kf+hl
  XP_015889931.1 244 LKALLDCAR-LADSEPDRAVKSLIRLKESVSEQGDPTERVTFHFTEALYKRVSM---QAEKSMSMYETT---SEEFTIPYKALNDACPYSKFAHL 331
                     689******.566688999999*******************************9...777777888887...8999999**************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     taNqaIlea+e+++++Hi+Df+i qG+QW+aLlqaLa+R+ g+p ++Ri g+ +p+ g   + +l +tg+rL++fA+ l+++fef++ v   +++
  XP_015889931.1 332 TANQAILEATERASKIHILDFGIVQGIQWAALLQALATRSTGKPiRIRISGIPAPALGksPAASLFATGNRLREFAKLLDLNFEFEP-VLIPIDE 425
                     ****************************************88887*********9999889999***********************.6889*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     l+ ++++v+p+E+laVn++lql++llde+    +   + L+l ksl+Pk+v++ e ea++n+  F++rf +al+yy+a+f+sle  l+r+s er 
  XP_015889931.1 426 LNQSSFKVDPDEVLAVNFMLQLYNLLDETPIAVQ---TALRLAKSLNPKIVTLGEYEASLNRVGFMTRFKNALRYYTAVFESLEPYLSRDSPERL 517
                     **************************88877777...9********************************************************* PP

            GRAS 284 kvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                      vEr llgr+i  +v  e+   +rer+e +e+W++ +e++ F+pvpls++a++qa+ ll +++ s  y++ e+   ++ l W++ pL++vS+Wr
  XP_015889931.1 518 EVERLLLGRRIAGLVGPEEPGsKRERTEDKEQWKSLMESSDFEPVPLSHYAVSQARILLWNYNySPLYSLIESPPGFLsLAWNEVPLLTVSSWR 611
                     ****************99886699***************************************9999**9888766666**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.539217589IPR005202Transcription factor GRAS
PfamPF035143.9E-106244611IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIK QKQQQEQQQQ QHHQQQQLTG LTPFSMSPWT TTHHGMSHTP  60
NMPYGLPPSG FPDPFQVPGG SDSGEPGFQF PHLEHQSTGF RFSDFGAGPG GEFDSDEWMD  120
SLMGGGDSTD SSNLPSGCDA WQSNADFGLY GADPFAACPS RLSVPCSSPS DLNRVLFTES  180
QKSPNPLQPQ VPAWTPPAPP TSPPVVVNDT KSINPPPKSV QKNDVVTGGV STSSPEIESA  240
PPLLKALLDC ARLADSEPDR AVKSLIRLKE SVSEQGDPTE RVTFHFTEAL YKRVSMQAEK  300
SMSMYETTSE EFTIPYKALN DACPYSKFAH LTANQAILEA TERASKIHIL DFGIVQGIQW  360
AALLQALATR STGKPIRIRI SGIPAPALGK SPAASLFATG NRLREFAKLL DLNFEFEPVL  420
IPIDELNQSS FKVDPDEVLA VNFMLQLYNL LDETPIAVQT ALRLAKSLNP KIVTLGEYEA  480
SLNRVGFMTR FKNALRYYTA VFESLEPYLS RDSPERLEVE RLLLGRRIAG LVGPEEPGSK  540
RERTEDKEQW KSLMESSDFE PVPLSHYAVS QARILLWNYN YSPLYSLIES PPGFLSLAWN  600
EVPLLTVSSW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1512426113375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889931.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLW9T1870.0W9T187_9R
STRINGVIT_04s0023g01660.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62803449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein